Please note our webshop is TEMPORARILY closed whilst undergoing updates.
Please phone us on 073902 3000 or email us at sales@banksiascientific.com.au for any enquiries and orders.

Recombinant SARS-CoV-2 Spike Protein

As prices subject to change please request a Quote

SKU: OPSN00001 Categories: ,

Description

Recombinant SARS-CoV-2 Spike Protein

Product Format Recombinant SARS-CoV-2 Spike Protein – Liquid. 50mM Tris, 2M Urea, 0.1 M NaCl, pH 8.0
Host E. Coli
Application AS
Additional Information UV280 Abs of 1 mg/mL: 1.1
Volume per vial: 4.1mL
Reconstitution and Storage 2 to 8C for short term (weeks), -70C for 24 months. Avoid frequent freeze/thaw.
Purification Affinity chromatography
Concentration 1.1 mg/mL, by absorbance at UV280
Protein Sequence AA 319 – 524
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATV
Datasheets/Manuals Printable datasheet for OPSN00001
Protein Name SARS-CoV-2 Spike Protein
Protein Size (# AA) 371
Molecular Weight 41 kDa
Protocol:
Tips Information: